Connecting...

W1siziisijiwmtcvmtavmdqvmdgvmdivmjivnje4l21haw4tymfubmvyxziuanbnil0swyjwiiwidgh1bwiilciymdawedewmdajil1d

about us

Established in early 2016, NextWave Partners was founded by two entrepreneurial recruitment consultants in their late 20s, motivated by a desire to drive the Energy & Infrastructure industry forward, with an ability to influence the market rather than to simply service it. 

In a short period of time, NextWave has established a leading recruitment brand in our key focus markets. We have done so by offering an unrivalled level of service to
our candidates and clients in terms of market knowledge, integrity and efficiency.

Our specialist recruitment consultants are seen as career coaches and market commentators. They take pride in continually gathering information and learning their
​core areas in detail, with the objective of giving NextWave’s candidates and clients a competitive advantage on the market and keeping them ahead of the curve.  

meet the team

W1siziisijiwmtgvmdevmjmvmdcvndivntmvotu3l0nsyxjsew5ux0zvdg9ylmpwzyjdlfsiccisinrodw1iiiwintaweduwmcmixv0

Clarlynn Tan

Senior Consultant - Renewable Energy, North East Asia

Upon obtaining my Accounting and Finance Bachelor's Degree from the University of London, I joine...

See More
W1siziisijiwmtcvmtavmdmvmdcvntqvnduvotc5l0fkyw1frm90b3iuanbnil0swyjwiiwidgh1bwiilci1mdb4ntawiyjdxq

Adam Wade

Director

With a Bachelor of Psychology (Behavioural Sciences) and Masters of Business, Human Resources Man...

See More
W1siziisijiwmtcvmtavmdmvmdgvmjgvmdqvmtq0l0nozxjpc2hfrm90b3iuanbnil0swyjwiiwidgh1bwiilci1mdb4ntawiyjdxq

Cherish Yew

Senior Consultant - Renewables & Investment

I graduated with a Bachelor's Degree in Finance, with 4 years front office finance experience, an...

See More
W1siziisijiwmtcvmtavmdmvmdgvnduvmjivmjg0l0fkaxrfrm90b3iuanbnil0swyjwiiwidgh1bwiilci1mdb4ntawiyjdxq

Adit Mehta

Associate Consultant - Renewables & Investment

A recent graduate, before my move to NextWave Partners, I was working on the Smart Power Initiati...

See More
W1siziisijiwmtcvmtavmdmvmdgvndqvntevmtgvtgf1cmffrm90b3iuanbnil0swyjwiiwidgh1bwiilci1mdb4ntawiyjdxq

Laura Wilson

Senior Consultant - CleanTech, Climate & Environment

I’ve spent over 12 years in the sourcing of specialist skill & mid-senior personnel across the En...

See More
W1siziisijiwmtcvmtavmdmvmtivndivmjcvmzq2l0fszxhfrm90b3iuanbnil0swyjwiiwidgh1bwiilci1mdb4ntawiyjdxq

Alex Bacciarelli

Director

Having 8 years direct Executive Search experience in the Energy Sector across all major markets, ...

See More
W1siziisijiwmtcvmtavmdmvmdgvndqvmzmvnje5l0nocmlzx0zvdg9ylmpwzyjdlfsiccisinrodw1iiiwintaweduwmcmixv0

Christopher Stephens

Senior Consultant - Power & Utilities

I started my career in recruitment, covering financial services roles, but have been focusing on ...

See More
W1siziisijiwmtcvmtavmdmvmdgvnduvmdyvotaxl01pa2vfrm90b3iuanbnil0swyjwiiwidgh1bwiilci1mdb4ntawiyjdxq

Mike Feely

Senior Consultant - Power Generation

I started my career in Recruitment in 2014 working for a small start-up, focusing on the global p...

See More
W1siziisijiwmtcvmtavmdmvmdgvmdqvmdkvmzi1l0ftyw5frm90b3iuanbnil0swyjwiiwidgh1bwiilci1mdb4ntawiyjdxq

Amandeep Talwar

Senior Recruitment Consultant - Technology

Having attained my MBA in Singapore, I kick-started my recruitment career within the tech domain ...

See More
W1siziisijiwmtcvmtavmdmvmdcvntevmdqvotixl0dlcmfszgluzv9gb3rvci5qcgcixsxbinailcj0ahvtyiisijuwmhg1mdajil1d

Geraldine Fok

Marketing & Business Support Manager

After having graduated with a Business Degree back in 2015, I began my career as a Marketing & Sa...

See More

news